PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.X7LBF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 253aa    MW: 28504.8 Da    PI: 6.7495
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.X7LBFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
      Aradu.X7LBF  66 RGNITLEEQLLILDLHSRWGNR-WSKIAEQLP-GRTDNEIKNYWRT 109
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.44E-2422107IPR009057Homeodomain-like
SMARTSM007172.1E-52462IPR001005SANT/Myb domain
PfamPF002491.9E-52560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-122667IPR009057Homeodomain-like
PROSITE profilePS5129423.20961115IPR017930Myb domain
SMARTSM007171.7E-1365113IPR001005SANT/Myb domain
PfamPF002492.6E-1466109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2168113IPR009057Homeodomain-like
CDDcd001675.60E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MIMRSLSDCG SSVANGSEED MEIRKGPWTE EEDSALLNHI TTYGLKRSGK SCRLRWLNYL  60
RPNVRRGNIT LEEQLLILDL HSRWGNRWSK IAEQLPGRTD NEIKNYWRTR VVKQAKQLKC  120
DVNSKQFRDA LRYVWMPRLM EQIQAQGRST MCVSQAREIV NPVTSVSTAS SKSCSSFSGC  180
EQFQASSSVS DSCVSYYSLM GSGSGAGSSE RVEKGATSSS TPFEPENGFG GADFWTDENI  240
WFLQQQLADD DHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242210724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015939423.11e-161PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE17e-62MY108_ARATH; Transcription factor MYB108
TrEMBLV7D1232e-98V7D123_PHAVU; Uncharacterized protein
STRINGGLYMA19G40650.12e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-72myb domain protein 2